PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B01589.1.p
Common NameEUGRSUZ_B01589
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family FAR1
Protein Properties Length: 631aa    MW: 72653.4 Da    PI: 7.933
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B01589.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR162.21.6e-191297290
              FAR1  2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90
                       Yn+YA   GF vrk ++ ++  +g   + tfvC++eg++ +   + e+++  r+++rtgC+a++k + e +g+wevtk+e  HnH++ 
  Eucgr.B01589.1.p 12 TYNAYAICKGFGVRKGQKANN-SKGVLRRCTFVCNCEGHSPSIPPH-EQRNIYRTVKRTGCEACIKFTIE-NGVWEVTKFEDVHNHPFI 97
                      6***************98887.7888*************9999888.99999*****************9.***************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.9E-161297IPR004330FAR1 DNA binding domain
PfamPF105511.3E-35219313IPR018289MULE transposase domain
PROSITE profilePS509669.705500536IPR007527Zinc finger, SWIM-type
PfamPF044341.4E-5508529IPR007527Zinc finger, SWIM-type
SMARTSM005750.0025511539IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 631 aa     Download sequence    Send to blast
MVFANENEAY NTYNAYAICK GFGVRKGQKA NNSKGVLRRC TFVCNCEGHS PSIPPHEQRN  60
IYRTVKRTGC EACIKFTIEN GVWEVTKFED VHNHPFIEDK QKHLIRSYRH ITDTSKGILT  120
SMTGAGIRAT KTYSYLCDEA GGANNIGFTL RDCQNFLQSK RRNLIDAGDC QRLINHFNYL  180
QSNGSNFSYT FQLDDDQRLT NVFWSDGLSK LDYDSFGDVV VFDTTYRTNK YNMICAPFVG  240
VNHHWKNVLF GCAFLMDETI ASFVWAFQSF LEAMGNKAPK TIFTDQDHAM ANAIRTVFPN  300
SDHRLCIWHI GKNDTHHIAH LLGKPGFRDK YWHKLLYRCE SEIEMETTWK AMCQEWNLSG  360
NKWLDNLYRL RHKWCPAFGR DFFSAGIRST QRSESTNNVF QDMACKTMTL SEFVGYYEKQ  420
AEKMCNTEIV DDFECARGKP HIMVETSGIL QHAAQVYTHV IYRNFQAEFL HVLSEHVLQS  480
ETDAPLHTYI VGTGSSERKH IVHFSPSDST IFCSCKLFEM QGWLCRHALY ILTNVANITS  540
IPSQYILKRW TKVAKQRIYC EDVAQSSHHA VNSKTLRLKR LMQLAFSVMN DSANHDVTEE  600
LATTALLRLR SQITTKMQSL IGKDHVDFLE E
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B01589.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010028203.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X2
RefseqXP_010028202.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_010028201.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_010028200.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_010028199.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_010028197.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
RefseqXP_010028196.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like isoform X1
TrEMBLA0A059D2Y30.0A0A059D2Y3_EUCGR; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM11826253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-114FAR1-related sequence 5